Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g04190.1
Common NameGL2-7, OJ1613_G04.7, Os08g0136000, Os08g0136100, OsJ_024924, P0680F05.46, ROC7
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 750aa    MW: 80854 Da    PI: 6.3916
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g04190.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
                       688999***********************************************999 PP

             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                       ela +a++elv++a+++ep+W      e + ++e+ ++f+++ +      ++ea+r+++vv+m+++ lve l+d++ qW+  +     +a+tl
                       57899********************99999*********998889*******************************.99999999999***** PP

             START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRael.lpSgiliepksnghskv 164
                       ev+s+g      galqlm+ae+q++splvp R+  f+Ry++q+++g+w++vdvS+d  +       ++  +R+++ +pSg+li++++ng+skv
                       *************************************************************9999********8537**************** PP

             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       twvehv+ +++++h+l++++v+sg+a+ga++wvatl+rqce+
                       ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.39486146IPR001356Homeobox domain
SMARTSM003891.1E-2087150IPR001356Homeobox domain
CDDcd000866.80E-2088147No hitNo description
PfamPF000462.3E-1889144IPR001356Homeobox domain
PROSITE patternPS000270121144IPR017970Homeobox, conserved site
PROSITE profilePS5084843.25256494IPR002913START domain
SuperFamilySSF559614.71E-34257493No hitNo description
CDDcd088751.15E-120260490No hitNo description
SMARTSM002347.2E-60265491IPR002913START domain
PfamPF018529.7E-53266491IPR002913START domain
Gene3DG3DSA:3.30.530.203.6E-5331490IPR023393START-like domain
SuperFamilySSF559614.85E-26511734No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.205760.0callus| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
Expression AtlasA3BPF2-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Phenotype -- Mutation ? help Back to Top
Source ID
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3185630.0AK318563.1 Oryza sativa Japonica Group cDNA, clone: J075197C04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648539.10.0PREDICTED: homeobox-leucine zipper protein ROC7
SwissprotA3BPF20.0ROC7_ORYSJ; Homeobox-leucine zipper protein ROC7
TrEMBLB9FYY90.0B9FYY9_ORYSJ; Os08g0136100 protein
STRINGLOC_Os08g04190.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2